PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G2170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family YABBY
Protein Properties Length: 211aa    MW: 23485.8 Da    PI: 7.896
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G2170genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY227.63.3e-70101752170
        YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 
                  d+   seq+Cyv+Cn C+t+lavsvP tslfk+vtvrCGhCt+ll vn++      a + hl +++  + ++ l+  ++       ++ ++s   +  
  Gh_D12G2170  10 DHLPPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLMPSANQFHLPHNFFTPSHNLLEEISNPSPNILLNQGNTSDI-TLP 106
                  577899******************************************9999999999999999998886555544444333333444433333.222 PP

        YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                    ++   +e+pr+p ++rPPekrqrvPsaynrfik+eiqrika+nPdi+hreafsaaaknWahfP+ihfgl
  Gh_D12G2170 107 --TRGVADELPRPPVINRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGL 175
                  ..3567889***999******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.6E-7014175IPR006780YABBY protein
SuperFamilySSF470951.02E-7119168IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.5E-4124167IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MSSSSTLSLD HLPPSEQLCY VHCNICDTVL AVSVPCTSLF KTVTVRCGHC TNLLPVNMRG  60
LLMPSANQFH LPHNFFTPSH NLLEEISNPS PNILLNQGNT SDITLPTRGV ADELPRPPVI  120
NRPPEKRQRV PSAYNRFIKD EIQRIKAGNP DITHREAFSA AAKNWAHFPH IHFGLMPDQP  180
AKRTNVRQQE GEDVLMKDGF FASANVGVTP Y
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.213000.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439507.11e-157PREDICTED: axial regulator YABBY 1-like isoform X1
RefseqXP_012439508.11e-157PREDICTED: axial regulator YABBY 1-like isoform X1
SwissprotO221523e-87YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A0D2T6N11e-157A0A0D2T6N1_G
STRINGVIT_02s0154g00070.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22172877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.12e-88YABBY family protein